Pfam domain
Pfam family: RRN3 (PF05327.13)
Uniprot AC: P36070
RecName: RNA polymerase I-specific transcription initiation factor RRN3
Begin-End: 202-464
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
NDTRRKLVNYTSNLLKLRGYCSELGFQIWSLLIEKIISIDVELQNELDELDDDVDDDDLE
EVDLEDDDDLDDDSGDDDDENCGNSNEELRSGAADGSQSDSEDMDIIEGMDGTEEYNVEL
TQGIKELSTKLDSILTLVSTHVEEQVTPESLESGEGVGVFNTLTTLFKTHVLPTYYTRSI
QYIMFHVSQQQLELMDSFLVTLIDISFAVNEAAEKKIKSLQYLGSYIARAKKLSRTQIIF
VASYLTSWLNRYVIEREEEVDQR
Structures of the domain P36070 202-464
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6tps X-ray 3.54 O 248-614 None
6ruo X-ray 3.5 O 247-614 None
5n61 X-ray 3.4 O 248-614 None
5oa1 X-ray 4.4 O 248-614 None
6rqt X-ray 4 O 248-614 None
6rqh X-ray 3.7 O 247-614 None


© NPIDB team 2003 - 2021

text