Pfam domain
Pfam family: TFIIS_M (PF07500.16)
Uniprot AC: P36106
RecName: Transcription factor BYE1
Begin-End: 233-362
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
KEHKLRYNAEKMFSTLFSKFIVPETIEAKLYELPDGKDVISISQEFAHNLEEELYKACLN
VEFGTLDKIYTEKVRSLYSNLKDKKNLELKAHVVEGKLPLNKLVNMNASELANPDLQEFK
EKRDKIILEN
Structures of the domain P36106 233-362
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4bxx X-ray 3.28 X 233-362 None
4by7 X-ray 3.15 X 233-362 None
4by1 X-ray 3.6 X 233-362 None


© NPIDB team 2003 - 2021

text