Pfam domain
Pfam family: RPC5 (PF04801.15)
Uniprot AC: P36121
RecName: DNA-directed RNA polymerase III subunit RPC5
Begin-End: 71-262
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
IEEFPLKISGEEESLHVFQYANRPRLVGRKPAEHPFISAARYKPKSHLWEIDIPLDEQAF
YNKDKAESEWNGVNVQTLKGVGVENNGQYAAFVKDMQVYLVPIERVAQLKPFFKYIDDAN
VTRKQEDARRNPNPSSQRAQVVTMSVKSVNDPSQNRLTGSLLAHKVADEEANIELTWAEG
TFEQFKDTIVKE
Structures of the domain P36121 71-262
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5fj8 X-ray 3.9 M 78-225 None
6cnc X-ray 4.1 M 78-225 None
6f44 X-ray 4.2 M 81-198 None
6f41 X-ray 4.3 M 81-201 None
6cnf X-ray 4.5 M 78-225 None
6f40 X-ray 3.7 M 81-201 None
6cnb X-ray 4.1 M 78-225 None
6f42 X-ray 5.5 M 78-240 None
6cnd X-ray 4.8 M 78-225 None


© NPIDB team 2003 - 2021

text