Pfam domain
Pfam family: RPC5 (PF04801.15)
Uniprot AC: P36121
RecName: DNA-directed RNA polymerase III subunit RPC5
Begin-End: 71-267
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
IEEFPLKISGEEESLHVFQYANRPRLVGRKPAEHPFISAARYKPKSHLWEIDIPLDEQAF
YNKDKAESEWNGVNVQTLKGVGVENNGQYAAFVKDMQVYLVPIERVAQLKPFFKYIDDAN
VTRKQEDARRNPNPSSQRAQVVTMSVKSVNDPSQNRLTGSLLAHKVADEEANIELTWAEG
TFEQFKDTIVKEAEDKT
Structures of the domain P36121 71-267
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6eu0 X-ray 4 M 71-266 None
6eu1 X-ray 3.4 M 71-264 None


© NPIDB team 2003 - 2021

text