Pfam domain
Pfam family: TFIIE_beta (PF02186.17)
Uniprot AC: P36145
RecName: Transcription initiation factor IIE subunit beta
Begin-End: 124-181
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
DSSKLLWATEYIQKKGKPVLVNELLDYLSMKKDDKVIELLKKLDRIEFDPKKGTFKYL
Structures of the domain P36145 124-181
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5fyw X-ray 4.35 X 124-188 None
5fz5 X-ray 8.8 X 124-188 None


© NPIDB team 2003 - 2021

text