Pfam domain
Pfam family: TFA2_Winged_2 (PF18121.3)
Uniprot AC: P36145
RecName: Transcription initiation factor IIE subunit beta
Begin-End: 187-247
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
HSPSELLKLLRSQVTFKGISCKDLKDGWPQCDETINQLEEDSKILVLRTKKDKTPRYVWY
N
Structures of the domain P36145 187-247
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5fmf X-ray 6 S 187-247 None
5fyw X-ray 4.35 X 187-247 None
5oqj X-ray 4.7 X 187-247 None
5fz5 X-ray 8.8 X 187-247 None
5oqm X-ray 5.8 X 187-247 None
6gym X-ray 6.7 X 187-247 None
6gyl X-ray 4.8 X 187-247 None
5sva X-ray 15.3 i 61-118 None


© NPIDB team 2003 - 2021

text