Pfam domain
Pfam family: HLH (PF00010.28)
Uniprot AC: P36956
RecName: Sterol regulatory element-binding protein 1
Begin-End: 324-374
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mj L-Bb 

Sequence:
KRTAHNAIEKRYRSSINDKIIELKDLVVGTEAKLNKSAVLRKAIDYIRFLQ
Structures of the domain P36956 324-374
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1am9 X-ray 2.3 A 324-374  H-Bb H-Mj L-Bb 
1am9 X-ray 2.3 B 324-374  H-Bb H-Mj L-Bb 
1am9 X-ray 2.3 C 324-374  H-Bb H-Mj L-Bb 
1am9 X-ray 2.3 D 324-374  H-Bb H-Mj L-Bb 


© NPIDB team 2003 - 2021

text