Pfam domain
Pfam family: Sigma54_activat (PF00158.28)
Uniprot AC: P37344
RecName: Psp operon transcriptional activator
Begin-End: 8-175
Organism: Escherichia coli
Interaction Mode:   

Sequence:
LLGEANSFLEVLEQVSHLAPLDKPVLIIGERGTGKELIASRLHYLSSRWQGPFISLNCAA
LNENLLDSELFGHEAGAFTGAQKRHPGRFERADGGTLFLDELATAPMMVQEKLLRVIEYG
ELERVGGSQPLQVNVRLVCATNADLPAMVNEGTFRADLLDRLAFDVVQ
Structures of the domain P37344 8-175
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5nss X-ray 5.8 N 9-170 None
5nss X-ray 5.8 L 9-170 None
5nss X-ray 5.8 K 9-170 None
5nss X-ray 5.8 F 9-170 None
5nss X-ray 5.8 G 9-170 None
5nss X-ray 5.8 J 9-170 None


© NPIDB team 2003 - 2021

text