Pfam domain
Pfam family: S4 (PF01479.27)
Uniprot AC: P37557
RecName: Uncharacterized protein YabO
Begin-End: 1-47
Organism: Bacillus subtilis
Interaction Mode:   

Sequence:
MRLDKFLKVSRLIKRRTLAKEVADQGRISINGNQAKASSDVKPGDEL
Structures of the domain P37557 1-47
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
7as8 X-ray 2.9 1 1-47 None
7aqc X-ray 2.99 Y 1-47 None


© NPIDB team 2003 - 2021

text