Pfam domain
Pfam family: MerR_1 (PF13411.8)
Uniprot AC: P37582
RecName: HTH-type transcriptional regulator GlnR
Begin-End: 13-81
Organism: Bacillus subtilis
Interaction Mode:  H-Bb H-Mj S-Bb L-Bb L-Mn 

Sequence:
PIGIVMQLTELSARQIRYYEENGLIFPARSEGNRRLFSFHDVDKLLEIKHLIEQGVNMAG
IKQILAKAE
Structures of the domain P37582 13-81
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4r4e X-ray 2.57 B 12-80  H-Bb H-Mj S-Bb L-Bb L-Mn 
4r4e X-ray 2.57 A 12-80 None


© NPIDB team 2003 - 2021

text