Pfam domain
Pfam family: RNA_pol_Rpb2_7 (PF04560.22)
Uniprot AC: P37870
RecName: DNA-directed RNA polymerase subunit beta
Begin-End: 1071-1145
Organism: Bacillus subtilis
Interaction Mode:   

Sequence:
GGQRFGEMEVWALEAYGAAYTLQEILTVKSDDVVGRVKTYEAIVKGDNVPEPGVPESFKV
LIKELQSLGMDVKIL
Structures of the domain P37870 1071-1145
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
7ckq X-ray 4.4 C 1071-1145 None


© NPIDB team 2003 - 2021

text