Pfam domain
Pfam family: RNA_pol_Rpb2_3 (PF04565.18)
Uniprot AC: P37870
RecName: DNA-directed RNA polymerase subunit beta
Begin-End: 469-537
Organism: Bacillus subtilis
Interaction Mode:   

Sequence:
QFMDQTNPLAELTHKRRLSALGPGGLTRERAGMEVRDVHYSHYGRMCPIETPEGPNIGLI
NSLSSYAKV
Structures of the domain P37870 469-537
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
7ckq X-ray 4.4 C 469-537  L-Mj 


© NPIDB team 2003 - 2021

text