Pfam domain
Pfam family: RNA_pol_Rpb2_6 (PF00562.30)
Uniprot AC: P37870
RecName: DNA-directed RNA polymerase subunit beta
Begin-End: 675-1069
Organism: Bacillus subtilis
Interaction Mode:   

Sequence:
ICKHPGIVERVEAKNVWVRRYEEVDGQKVKGNLDKYSLLKFVRSNQGTCYNQRPIVSVGD
EVVKGEILADGPSMELGELALGRNVMVGFMTWDGYNYEDAIIMSERLVKDDVYTSIHIEE
YESEARDTKLGPEEITRDIPNVGEDALRNLDDRGIIRIGAEVKDGDLLVGKVTPKGVTEL
TAEERLLHAIFGEKAREVRDTSLRVPHGGGGIIHDVKVFNREDGDELPPGVNQLVRVYIV
QKRKISEGDKMAGRHGNKGVISKILPEEDMPYLPDGTPIDIMLNPLGVPSRMNIGQVLEL
HMGMAARYLGIHIASPVFDGAREEDVWETLEEAGMSRDAKTVLYDGRTGEPFDNRVSVGI
MYMIKLAHMVDDKLHARSTGPYSLVTQQPLGGKAQ
Structures of the domain P37870 675-1069
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
7ckq X-ray 4.4 C 675-1069 None


© NPIDB team 2003 - 2021

text