Pfam domain
Pfam family: RNA_pol_Rpb1_2 (PF00623.22)
Uniprot AC: P37871
RecName: DNA-directed RNA polymerase subunit beta'
Begin-End: 333-396
Organism: Bacillus subtilis
Interaction Mode:   

Sequence:
GKRVDYSGRSVIVVGPHLKMYQCGLPKEMALELFKPFVMKELVEKGLAHNIKSAKRKIER
VQPE
Structures of the domain P37871 333-396
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
7ckq X-ray 4.4 D 333-396 None


© NPIDB team 2003 - 2021

text