Pfam domain
Pfam family: WD40 (PF00400.34)
Uniprot AC: P38123
RecName: COMPASS component SWD3
Begin-End: 44-82
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
RTVSQTLVTSHARPFSELCWSPDGQCIATASDDFSVEII
Structures of the domain P38123 44-82
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6ven X-ray 3.37 L 86-124 None


© NPIDB team 2003 - 2021

text