Pfam domain
Pfam family: MCM_N (PF14551.8)
Uniprot AC: P38132
RecName: DNA replication licensing factor MCM7
Begin-End: 18-206
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
FNEITDFLVTFKQDTLSSDATRNENEDENLDAENIEQHLLEKGPKYMAMLQKVANRELNS
VIIDLDDILQYQNEKFLQGTQADDLVSAIQQNANHFTELFCRAIDNNMPLPTKEIDYKDD
VLDVILNQRRLRNERMLSDRTNEIRSENLMDTTMDPPSSMNDALREVVEDETELFPPNLT
RRYFLYFKP
Structures of the domain P38132 18-206
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6f0l X-ray 4.77 F 20-206 None
6f0l X-ray 4.77 7 20-206 None
5u8t X-ray 4.9 7 20-206 None
6wgg X-ray 8.1 7 20-205 None
5u8s X-ray 6.1 7 20-206 None
5bk4 X-ray 3.9 F 20-206 None
5bk4 X-ray 3.9 7 20-206 None
6wgi X-ray 10 7 20-205 None
5v8f X-ray 3.9 7 20-206 None
6u0m X-ray 3.9 7 20-206 None
6hv9 X-ray 4.98 7 20-205 None


© NPIDB team 2003 - 2021

text