Pfam domain
Pfam family: SNF2-rel_dom (PF00176.25)
Uniprot AC: P38144
RecName: ISWI chromatin-remodeling complex ATPase ISW1
Begin-End: 199-482
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
YQIQGVNWLVSLHKNKIAGILADEMGLGKTLQTISFLGYLRYIEKIPGPFLVIAPKSTLN
NWLREINRWTPDVNAFILQGDKEERAELIQKKLLGCDFDVVIASYEIIIREKSPLKKINW
EYIIIDEAHRIKNEESMLSQVLREFTSRNRLLITGTPLQNNLHELWALLNFLLPDIFSDA
QDFDDWFSSESTEEDQDKIVKQLHTVLQPFLLRRIKSDVETSLLPKKELNLYVGMSSMQK
KWYKKILEKDLDAVNGSNGSKESKTRLLNIMMQLRKCCNHPYLF
Structures of the domain P38144 199-482
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6jyl X-ray 3.37 K 199-482  H-Bb H-Mn L-Bb 
6k1p X-ray 3.87 K 199-482  H-Bb L-Bb 
6iro X-ray 3.4 L 199-482  H-Bb L-Bb 


© NPIDB team 2003 - 2021

text