Pfam domain
Pfam family: Cnd2 (PF05786.16)
Uniprot AC: P38170
RecName: Condensin complex subunit 2
Begin-End: 384-524
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
SIFEKDLMAYFDENLNRNWRGREHWKVRNFKKANLVNKESDLLEETRTTIGDTTDKNTTD
DKSMDTKKKHKQKKVLEIDFFKTDDSFEDKVFASKGRTKIDMPIKNRKNDTHYLLPDDFH
FSTDRITRLFIKPGQKMSLFS
Structures of the domain P38170 384-524
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5oqo X-ray 3.25 B 384-523 None
5oqp X-ray 2.98 B 385-522  L-Bb L-Mj 


© NPIDB team 2003 - 2021

text