Pfam domain
Pfam family: Cnd2 (PF05786.16)
Uniprot AC: P38170
RecName: Condensin complex subunit 2
Begin-End: 386-417
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
FEKDLMAYFDENLNRNWRGREHWKVRNFKKAN
Structures of the domain P38170 386-417
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5oqn X-ray 3.15 B 384-460 None


© NPIDB team 2003 - 2021

text