Pfam domain
Pfam family: Cnd2 (PF05786.16)
Uniprot AC: P38170
RecName: Condensin complex subunit 2
Begin-End: 413-480
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
FKKANLVNKESDLLEETRTTIGDTTDKNTTDDKSMDTKKKHKQKKVLEIDFFKTDDSFED
KVFASKGR
Structures of the domain P38170 413-480
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5oqn X-ray 3.15 B 456-523 None


© NPIDB team 2003 - 2021

text