Pfam domain
Pfam family: Med8 (PF10232.11)
Uniprot AC: P38304
RecName: Mediator of RNA polymerase II transcription subunit 8
Begin-End: 31-210
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
QALDAVRMRLAQLTHSLRRIRDEMSKAELPQWYTLQSQLNVTLSQLVSVTSTLQHFQETL
DSTVVYPLPKFPTTSHESLVTTLLRKKNIPEVDEWMKYVRETSGVTTALLKDEEIEKLLQ
QDREITNWARTTFRNEYGKHDFKNEESLSEEHASLLVRDSKPSKPFNVDDVLKFTFTGEK
Structures of the domain P38304 31-210
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4v1o X-ray 9.7 U 31-171 None
5oqm X-ray 5.8 b 31-171 None
5sva X-ray 15.3 N 30-208 None


© NPIDB team 2003 - 2021

text