Pfam domain
Pfam family: Med31 (PF05669.14)
Uniprot AC: P38633
RecName: Mediator of RNA polymerase II transcription subunit 31
Begin-End: 20-107
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
PTRFEVELEFIQSLANIQYVTYLLTQQQIWKSPNFKNYLKYLEYWCNPPYSQCIVYPNCL
FILKLLNGFMESAIVNEDGLLEGLDELP
Structures of the domain P38633 20-107
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5sva X-ray 15.3 X 20-102 None


© NPIDB team 2003 - 2021

text