Pfam domain
Pfam family: Ribosomal_S10 (PF00338.24)
Uniprot AC: P38701
RecName: 40S ribosomal protein S20
Begin-End: 23-117
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
RITLTSTKVKQLENVSSNIVKNAEQHNLVKKGPVRLPTKVLKISTRKTPNGEGSKTWETY
EMRIHKRYIDLEAPVQIVKRITQITIEPGVDVEVV
Structures of the domain P38701 23-117
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6fai X-ray 3.4 U 23-117 None
6zce X-ray 5.3 V 23-117 None
6zvi X-ray 3 C 23-117 None
6rbe X-ray 3.8 U 23-117 None
7a1g X-ray 3 K 23-117 None
6zu9 X-ray 6.2 L 23-117 None
6wdr X-ray 3.7 U 23-117 None


© NPIDB team 2003 - 2021

text