Pfam domain
Pfam family: Med6 (PF04934.16)
Uniprot AC: P38782
RecName: Mediator of RNA polymerase II transcription subunit 6
Begin-End: 9-195
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
LQWKSPEWIQVFGLRTENVLDYFAESPFFDKTSNNQVIKMQRQFSQLNDPNAAVNMTQNI
MTLPDGKNGNLEEEFAYVDPARRQILFKYPMYMQLEEELMKLDGTEYVLSSVREPDFWVI
RKQRRTNNSGVGSAKGPEIIPLQDYYIIGANIYQSPTIFKIVQSRLMSTSYHLNSTLESL
YDLIEFQ
Structures of the domain P38782 9-195
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4v1o X-ray 9.7 S 9-195 None
5oqm X-ray 5.8 a 3-130 None
5sva X-ray 15.3 M 9-192 None


© NPIDB team 2003 - 2021

text