Pfam domain
Pfam family: N-SET (PF11764.10)
Uniprot AC: P38827
RecName: Histone-lysine N-methyltransferase, H3 lysine-4 specific
Begin-End: 803-932
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
SRRKVLEEEKASDWQIELNGTLFDSELQPGSSFKAEGFRKIADKLKINYLPHRRRVHQPL
NTVNIHNERNEYTPELCQREESSNKEPSDSVPQEVSSSRDNRASNRRFQQDIEAQKAAIG
TESELLSLNQ
Structures of the domain P38827 803-932
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6ven X-ray 3.37 N 849-932 None


© NPIDB team 2003 - 2021

text