Pfam domain
Pfam family: SET (PF00856.30)
Uniprot AC: P38827
RecName: Histone-lysine N-methyltransferase, H3 lysine-4 specific
Begin-End: 949-1055
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
NWGLYALDSIAAKEMIIEYVGERIRQPVAEMREKRYLKNGIGSSYLFRVDENTVIDATKK
GGIARFINHCCDPNCTAKIIKVGGRRRIVIYALRDIAASEELTYDYK
Structures of the domain P38827 949-1055
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6ven X-ray 3.37 N 949-1055 None


© NPIDB team 2003 - 2021

text