Pfam domain
Pfam family: MerR_1 (PF13411.8)
Uniprot AC: P39075
RecName: Multidrug-efflux transporter 1 regulator
Begin-End: 5-74
Organism: Bacillus subtilis
Interaction Mode:   

Sequence:
YYSIGEVSKLANVSIKALRYYDKIDLFKPAYVDPDTSYRYYTDSQLIHLDLIKSLKYIGT
PLEEMKKAQD
Structures of the domain P39075 5-74
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3d70 X-ray 2.8 A 6-75 None
3q3d X-ray 2.79 A 6-75 None
3d71 X-ray 2.8 A 6-75 None
3d6z X-ray 2.6 A 6-75 None
3q2y X-ray 2.95 A 6-75 None
1r8e X-ray 2.4 A 6-75 None
3d6y X-ray 2.7 A 6-75 None
1exj X-ray 3 A 6-75 None
1exi X-ray 3.12 A 6-75 None
3q5r X-ray 3.05 A 6-75 None
3q5s X-ray 3.1 A 6-75 None
3q1m X-ray 3.2 A 6-75 None
3q5p X-ray 2.94 A 6-75 None


© NPIDB team 2003 - 2021

text