Pfam domain
Pfam family: WD40 (PF00400.34)
Uniprot AC: P39706
RecName: COMPASS component SWD1
Begin-End: 62-100
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
CVPGNMLGAHVRPITSIAWSPDGRLLLTSSRDWSIKLWD
Structures of the domain P39706 62-100
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6ven X-ray 3.37 M 62-100 None


© NPIDB team 2003 - 2021

text