Pfam domain
Pfam family: XPG_I (PF00867.20)
Uniprot AC: P39748
RecName: Flap endonuclease 1
Begin-End: 149-233
Organism: Homo sapiens
Interaction Mode:  H-Bb S-Bb L-Bb 

Sequence:
GIPYLDAPSEAEASCAALVKAGKVYAAATEDMDCLTFGSPVLMRHLTASEAKKLPIQEFH
LSRILQELGLNQEQFVDLCILLGSD
Structures of the domain P39748 149-233
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6tnz X-ray 4.05 H 149-233 None
3q8l X-ray 2.32 A 149-233  L-Bb 
3q8k X-ray 2.2 A 149-233 None
3q8m X-ray 2.6 B 149-233 None
3q8m X-ray 2.6 A 149-233 None
5zof X-ray 2.25 A 149-233  H-Bb 
5um9 X-ray 2.81 A 149-233  L-Bb 
5zoe X-ray 1.95 A 149-233  H-Bb L-Bb 
5zog X-ray 2.3 A 149-233  H-Bb 
5kse X-ray 2.11 A 149-233  H-Bb S-Bb L-Bb 
5k97 X-ray 2.1 A 149-233 None


© NPIDB team 2003 - 2021

text