Pfam domain
Pfam family: Myb_DNA-bind_6 (PF13921.8)
Uniprot AC: P39964
RecName: Pre-mRNA-splicing factor cdc5
Begin-End: 3-63
Organism: Schizosaccharomyces pombe
Interaction Mode:   

Sequence:
VLKGGAWKNTEDEILKAAVSKYGKNQWARISSLLVRKTPKQCKARWYEWIDPSIKKTEWS
R
Structures of the domain P39964 3-63
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3jb9 X-ray 3.6 W 9-69 None


© NPIDB team 2003 - 2021

text