Pfam domain
Pfam family: SNF2-rel_dom (PF00176.25)
Uniprot AC: P40352
RecName: DNA repair and recombination protein RAD26
Begin-End: 247-631
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
YQERLKKWVKQRSCGSQRSSDLPEWRRPHPNIPDAKLNSQFKIPGEIYSLLFNYQKTCVQ
WLYELYQQNCGGIIGDEMGLGKTIQVIAFIAALHHSGLLTGPVLIVCPATVMKQWCNEFQ
HWWPPLRTVILHSMGSGMASDQKFKMDENDLENLIMNSKPSDFSYEDWKNSTRTKKALES
SYHLDKLIDKVVTDGHILITTYVGLRIHSDKLLKVKWQYAVLDEGHKIRNPDSEISLTCK
KLKTHNRIILSGTPIQNNLTELWSLFDFIFPGKLGTLPVFQQQFVIPINIGGYANATNIQ
VQTGYKCAVALRDLISPYLLRRVKADVAKDLPQKKEMVLFCKLTKYQRSKYLEFLHSSDL
NQIQNGKRNVLFGIDILRKICNHPD
Structures of the domain P40352 247-631
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5vvr X-ray 5.8 M 299-631  H-Bb L-Bb 


© NPIDB team 2003 - 2021

text