Pfam domain
Pfam family: Homeodomain (PF00046.31)
Uniprot AC: P40427
RecName: Homeobox protein extradenticle
Begin-End: 242-298
Organism: Drosophila melanogaster
Interaction Mode:  H-Bb H-Mj L-Bb L-Mj L-Mn 

Sequence:
RRNFSKQASEILNEYFYSHLSNPYPSEEAKEELARKCGITVSQVSNWFGNKRIRYKK
Structures of the domain P40427 242-298
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1b8i X-ray 2.4 B 205-261  H-Bb H-Mj L-Bb L-Mn 
2r5z X-ray 2.6 B 205-257  H-Bb H-Mj L-Bb L-Mn 
2r5y X-ray 2.6 B 205-257  H-Bb H-Mj L-Bb L-Mn 
5zjq X-ray 2.44 B 3-62  H-Bb H-Mj L-Bb L-Mn 
4uus X-ray 2.55 F 8-58  H-Bb H-Mj L-Bb 
4uus X-ray 2.55 B 7-58  H-Bb H-Mj L-Bb 
4cyc X-ray 2.36 B 3-58  H-Bb H-Mj L-Bb L-Mn 
5zjr X-ray 3.03 B 3-62  H-Bb H-Mj L-Bb 
5zjs X-ray 2.9 B 3-62  H-Bb H-Mj L-Bb 
5zjt X-ray 2.4 B 3-62  H-Bb H-Mj L-Bb L-Mj L-Mn 


© NPIDB team 2003 - 2021

text