Pfam domain
Pfam family: Myb_DNA-bind_6 (PF13921.8)
Uniprot AC: P40968
RecName: Pre-mRNA-processing factor 17
Begin-End: 10-70
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
SSDSDLNFDEGKSVHEKKNGNLHEDTSYEPSSNNIHKRKSHFTKSELKRRRKTRKGDGPW
G
Structures of the domain P40968 10-70
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6exn X-ray 3.7 O 60-192 None
5mps X-ray 3.85 O 59-200 None
5mq0 X-ray 4.17 O 13-73 None


© NPIDB team 2003 - 2021

text