Pfam domain
Pfam family: Zn_clus (PF00172.20)
Uniprot AC: P40969
RecName: Centromere DNA-binding protein complex CBF3 subunit B
Begin-End: 12-51
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
HPCSVCTRRKVKCDRMIPCGNCRKRGQDSECMKSTKLITA
Structures of the domain P40969 12-51
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6gys X-ray 4.4 I 12-51 None
6gys X-ray 4.4 C 12-54  L-Bb L-Mj 
6gys X-ray 4.4 J 12-54  L-Bb L-Mj 
6gys X-ray 4.4 B 12-51 None


© NPIDB team 2003 - 2021

text