Pfam domain
Pfam family: zf-RRN7 (PF11781.10)
Uniprot AC: P40992
RecName: RNA polymerase I-specific transcription initiation factor RRN7
Begin-End: 4-35
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
FIRGPICGTDNCPSRLWRIIDGRRTCQYGHVM
Structures of the domain P40992 4-35
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6tps X-ray 3.54 Q 4-37 None
6ruo X-ray 3.5 Q 4-37 None
6rrd X-ray 3.1 Q 4-37 None
6rql X-ray 2.9 Q 4-37 None
5n61 X-ray 3.4 Q 4-95 None
5w65 X-ray 4.3 P 4-37 None
6rqh X-ray 3.7 Q 4-37 None
6rwe X-ray 3 Q 4-37 None
6rui X-ray 2.7 Q 4-37 None


© NPIDB team 2003 - 2021

text