Pfam domain
Pfam family: zf-dskA_traR (PF01258.19)
Uniprot AC: P41065
RecName: Protein TraR
Begin-End: 31-67
Organism: Escherichia coli
Interaction Mode:   

Sequence:
GIPVYLCEACGNPIPEARRKIFPGVTLCVECQAYQER
Structures of the domain P41065 31-67
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6psu X-ray 3.9 N 31-67 None
6psv X-ray 3.5 N 31-67 None
6psw X-ray 3.7 N 31-67 None
6pst X-ray 3 N 31-67 None
6pss X-ray 3.5 N 31-67 None
6psr X-ray 3.4 N 31-67 None
6psq X-ray 3.4 N 31-67 None


© NPIDB team 2003 - 2021

text