Pfam domain
Pfam family: DEAD (PF00270.31)
Uniprot AC: P41223
RecName: Protein BUD31 homolog
Begin-End: 9-172
Organism: Homo sapiens
Interaction Mode:   

Sequence:
KAPPDGWELIEPTLDELDQKMREAETEPHEGKRKVESLWPIFRIHHQKTRYIFDLFYKRK
AISRELYEYCIKEGYADKNLIAKWKKQGYENLCCLRCIQTRDTNFGTNCICRVPKSKLEV
GRIIECTHCGCRGCSG
Structures of the domain P41223 9-172
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5mqf X-ray 5.9 q 565-728 None


© NPIDB team 2003 - 2021

text