Pfam domain
Pfam family: TFIIF_alpha (PF05793.14)
Uniprot AC: P41895
RecName: Transcription initiation factor IIF subunit alpha
Begin-End: 293-417
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
KEVTNEPEFEEGTMDPLADVAPDGGGRAKRGNLRRKTRQLKVLDENAKKLRFEEFYPWVM
EDFDGYNTWVGSYEAGNSDSYVLLSVEDDGSFTMIPADKVYKFTARNKYATLTIDEAEKR
MDKKS
Structures of the domain P41895 293-417
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5fmf X-ray 6 U 95-417 None


© NPIDB team 2003 - 2021

text