Pfam domain
Pfam family: TFIIF_alpha (PF05793.14)
Uniprot AC: P41895
RecName: Transcription initiation factor IIF subunit alpha
Begin-End: 327-415
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
RKTRQLKVLDENAKKLRFEEFYPWVMEDFDGYNTWVGSYEAGNSDSYVLLSVEDDGSFTM
IPADKVYKFTARNKYATLTIDEAEKRMDK
Structures of the domain P41895 327-415
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5fyw X-ray 4.35 Q 98-415 None
6gyk X-ray 5.1 Q 98-415 None
5oqj X-ray 4.7 Q 98-415 None
5fz5 X-ray 8.8 Q 98-415 None
6gym X-ray 6.7 Q 98-415 None
6gyl X-ray 4.8 Q 98-415 None
5sva X-ray 15.3 f 86-417  L-Bb 


© NPIDB team 2003 - 2021

text