Pfam domain
Pfam family: TFIIF_beta (PF02270.17)
Uniprot AC: P41896
RecName: Transcription initiation factor IIF subunit beta
Begin-End: 292-356
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
IRMPKKEILDYLFKLFDEYDYWSLKGLKERTRQPEAHLKECLDKVATLVKKGPYAFKYTL
RPEYK
Structures of the domain P41896 292-356
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5fmf X-ray 6 V 292-356  H-Bb H-Mj L-Bb L-Mj 
5fyw X-ray 4.35 R 279-362  H-Bb H-Mj 
5fz5 X-ray 8.8 R 279-362 None
5sva X-ray 15.3 g 292-356 None


© NPIDB team 2003 - 2021

text