Pfam domain
Pfam family: TFIIF_beta (PF02270.17)
Uniprot AC: P41896
RecName: Transcription initiation factor IIF subunit beta
Begin-End: 294-351
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
MPKKEILDYLFKLFDEYDYWSLKGLKERTRQPEAHLKECLDKVATLVKKGPYAFKYTL
Structures of the domain P41896 294-351
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5oqj X-ray 4.7 R 279-351 None
5oqm X-ray 5.8 R 279-351 None
6gym X-ray 6.7 R 279-351 None
6gyl X-ray 4.8 R 279-351 None


© NPIDB team 2003 - 2021

text