Pfam domain
Pfam family: TFIIF_beta_N (PF17683.3)
Uniprot AC: P41896
RecName: Transcription initiation factor IIF subunit beta
Begin-End: 65-227
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
NRQVWLVRLPMFLAEKWRDRNNLHGQELGKIRINKDGSKITLLLNENDNDSIPHEYDLEL
TKKVVENEYVFTEQNLKKYQQRKKELEADPEKQRQAYLKKQEREEELKKKQQQQKRRNNR
KKFNHRVMTDRDGRDRYIPYVKTIPKKTAIVGTVCHECQVMPS
Structures of the domain P41896 65-227
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5fmf X-ray 6 V 65-212 None
4v1o X-ray 9.7 R 65-211 None
5fyw X-ray 4.35 R 65-207 None
4v1n X-ray 7.8 R 65-211 None
6gyk X-ray 5.1 R 65-209 None
5oqj X-ray 4.7 R 65-207 None
5fz5 X-ray 8.8 R 65-207 None
5oqm X-ray 5.8 R 65-207 None
6gym X-ray 6.7 R 65-207 None
6gyl X-ray 4.8 R 65-207 None
5sva X-ray 15.3 g 65-211 None


© NPIDB team 2003 - 2021

text