Pfam domain
Pfam family: DEAD (PF00270.31)
Uniprot AC: P42285
RecName: Exosome RNA helicase MTR4
Begin-End: 141-292
Organism: Homo sapiens
Interaction Mode:   

Sequence:
DAFQREAIQCVDNNQSVLVSAHTSAGKTVCAEYAIALALREKQRVIFTSPIKALSNQKYR
EMYEEFQDVGLMTGDVTINPTASCLVMTTEILRSMLYRGSEVMREVAWVIFDEIHYMRDS
ERGVVWEETIILLPDNVHYVFLSATIPNARQF
Structures of the domain P42285 141-292
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6d6q X-ray 3.45 M 141-292 None
6d6r X-ray 3.45 M 141-292 None


© NPIDB team 2003 - 2021

text