Pfam domain
Pfam family: H2TH (PF06831.16)
Uniprot AC: P42371
RecName: Formamidopyrimidine-DNA glycosylase
Begin-End: 132-221
Organism: Lactococcus lactis subsp. cremoris
Interaction Mode:  H-Bb L-Bb 

Sequence:
IGPEPTYDEDFDEKLFREKLRKSTKKIKPYLLEQTLVAGLGNIYVDEVLWLAKIHPEKET
NQLIESSIHLLHDSIIEILQKAIKLGGSSI
Structures of the domain P42371 132-221
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6rnr X-ray 2 A 131-218  H-Bb 
1pji X-ray 1.9 A 131-223  H-Bb L-Bb 
6rp0 X-ray 2.25 A 131-218  H-Bb L-Bb 
1nnj X-ray 1.9 A 131-224  H-Bb 
3c58 X-ray 1.9 A 131-220  H-Bb 
1pjj X-ray 1.9 A 131-222  H-Bb 
1pm5 X-ray 1.95 A 131-222  H-Bb 
1kfv X-ray 2.55 B 131-232  H-Bb 
1kfv X-ray 2.55 A 131-228  H-Bb 
2xzu X-ray 1.82 A 131-218  H-Bb 
1xc8 X-ray 1.95 A 131-222  H-Bb L-Bb 
1tdz X-ray 1.8 A 131-219  H-Bb L-Bb 
2xzf X-ray 1.8 A 131-218  H-Bb 
4pdg X-ray 2.4 A 131-218  H-Bb L-Bb 
4pdi X-ray 2.1 A 131-220  H-Bb L-Bb 
4pcz X-ray 1.7 A 131-222  H-Bb 
4pd2 X-ray 1.65 A 131-222  H-Bb 
6ro2 X-ray 1.82 A 131-218  H-Bb 
6rp7 X-ray 2 A 131-223  H-Bb L-Bb 
6h0s X-ray 1.75 A 131-222  H-Bb 
6rno X-ray 2.25 A 131-224  H-Bb L-Bb 
6rok X-ray 1.95 A 131-222  H-Bb 
6rnm X-ray 1.76 A 131-222  H-Bb 


© NPIDB team 2003 - 2021

text