Pfam domain
Pfam family: NTP_transf_2 (PF01909.25)
Uniprot AC: P42494
RecName: Repair DNA polymerase X
Begin-End: 14-138
Organism: African swine fever virus
Interaction Mode:  H-Bb H-Mj H-Mn S-Bb S-Mn L-Bb 

Sequence:
LRSRLAFEYNGQLIKILSKNIVAVGSLRREEKMLNDVDLLIIVPEKKLLKHVLPNIRIKG
LSFSVKVCGERKCVLFIEWEKKTYQLDLFTALAEEKPYAIFHFTGPVSYLIRIRAALKKK
NYKLN
Structures of the domain P42494 14-138
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5xm8 X-ray 2.55 D 13-137  H-Bb H-Mj H-Mn S-Bb L-Bb 
5xm8 X-ray 2.55 C 13-137  H-Bb H-Mj H-Mn S-Bb L-Bb 
5xm8 X-ray 2.55 B 13-137  H-Bb H-Mj H-Mn S-Bb L-Bb 
5xm8 X-ray 2.55 A 13-137  H-Bb H-Mj H-Mn S-Bb S-Mn L-Bb 
5hrb X-ray 1.7 A 13-137  H-Bb H-Mj H-Mn S-Bb S-Mn L-Bb 
5hrd X-ray 1.8 C 13-137  H-Bb H-Mj H-Mn S-Bb S-Mn L-Bb 
5hrd X-ray 1.8 D 13-137  H-Bb H-Mj H-Mn S-Bb S-Mn L-Bb 
5hrd X-ray 1.8 B 13-137  H-Bb H-Mj H-Mn S-Bb L-Bb 
5hrd X-ray 1.8 A 13-137  H-Bb H-Mj H-Mn S-Bb S-Mn L-Bb 
5hrl X-ray 2.4 B 13-137  H-Bb H-Mj H-Mn S-Bb L-Bb 
5hrl X-ray 2.4 A 13-137  H-Bb H-Mj H-Mn S-Bb L-Bb 
5hre X-ray 1.75 A 13-137 None
5hrf X-ray 2.25 B 11-137  H-Bb H-Mn S-Bb L-Bb 
5hrf X-ray 2.25 A 13-136  H-Bb H-Mn S-Bb S-Mn L-Bb 
5hri X-ray 2.2 B 13-137  H-Bb H-Mj H-Mn S-Bb L-Bb 
5hri X-ray 2.2 A 13-137  H-Bb H-Mj H-Mn S-Bb L-Bb 
2m2w NMR A 13-137  L-Bb L-Mn 
5xma X-ray 3.8 B 13-137  H-Bb H-Mj H-Mn S-Bb 
5xma X-ray 3.8 A 13-137  H-Bb H-Mj H-Mn S-Bb 


© NPIDB team 2003 - 2021

text