Pfam domain
Pfam family: zf-C4 (PF00105.20)
Uniprot AC: P43354
RecName: Nuclear receptor subfamily 4 group A member 2
Begin-End: 262-330
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mj S-Bb S-Mj L-Bb L-Mj 

Sequence:
LCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKNAKYVCLANKNCPVDKRRRNRCQYCRFQ
KCLAVGMVK
Structures of the domain P43354 262-330
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6l6l X-ray 2.78 B 262-330  H-Bb H-Mj S-Bb S-Mj L-Bb 
6l6l X-ray 2.78 A 262-330  H-Bb H-Mj S-Bb S-Mj L-Bb L-Mj 
6l6q X-ray 2.6 B 262-330  H-Bb H-Mj S-Bb S-Mj L-Bb 
6l6q X-ray 2.6 A 262-330  H-Bb H-Mj S-Bb S-Mj L-Bb L-Mj 


© NPIDB team 2003 - 2021

text