Pfam domain
Pfam family: ZZ (PF00569.19)
Uniprot AC: P43609
RecName: Chromatin structure-remodeling complex protein RSC8
Begin-End: 254-298
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
IHKVYICHTCGNESINVRYHNLRARDTNLCSRCFQEGHFGANFQS
Structures of the domain P43609 254-298
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6kw4 X-ray 7.55 H 254-298 None
6kw3 X-ray 7.13 H 254-298 None
6kw5 X-ray 10.13 H 254-298 None
6tda X-ray 15 L 195-298 None
6v92 X-ray 20 L 254-298 None
6v92 X-ray 20 I 254-298 None


© NPIDB team 2003 - 2021

text