Pfam domain
Pfam family: Myb_DNA-binding (PF00249.33)
Uniprot AC: P43609
RecName: Chromatin structure-remodeling complex protein RSC8
Begin-End: 312-358
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
KKNWSDQEMLLLLEGIEMYEDQWEKIADHVGGHKRVEDCIEKFLSLP
Structures of the domain P43609 312-358
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6kw4 X-ray 7.55 D 312-357 None
6kw4 X-ray 7.55 H 312-357 None
6kw3 X-ray 7.13 D 312-357 None
6kw3 X-ray 7.13 H 312-357 None
6kw5 X-ray 10.13 H 312-357 None
6kw5 X-ray 10.13 D 312-357 None
6tda X-ray 15 L 1312-1357 None
6tda X-ray 15 L 306-357 None
6v92 X-ray 20 L 312-357 None
6v92 X-ray 20 I 312-357 None


© NPIDB team 2003 - 2021

text