Pfam domain
Pfam family: SWIRM-assoc_1 (PF16495.7)
Uniprot AC: P43609
RecName: Chromatin structure-remodeling complex protein RSC8
Begin-End: 406-486
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
KLGKVSDKSREISEKYIEESQAIIQELVKLTMEKLESKFTKLCDLETQLEMEKLKYVKES
EKMLNDRLSLSKQILDLNKSL
Structures of the domain P43609 406-486
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6kw4 X-ray 7.55 H 407-485 None
6kw3 X-ray 7.13 H 407-485 None
6kw5 X-ray 10.13 H 407-485 None
6tda X-ray 15 L 1424-1486 None
6tda X-ray 15 L 407-486 None
6v92 X-ray 20 J 407-486 None


© NPIDB team 2003 - 2021

text