Pfam domain
Pfam family: SWIRM-assoc_1 (PF16495.7)
Uniprot AC: P43609
RecName: Chromatin structure-remodeling complex protein RSC8
Begin-End: 415-486
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
REISEKYIEESQAIIQELVKLTMEKLESKFTKLCDLETQLEMEKLKYVKESEKMLNDRLS
LSKQILDLNKSL
Structures of the domain P43609 415-486
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6kw4 X-ray 7.55 D 423-485 None
6kw3 X-ray 7.13 D 423-485 None
6kw5 X-ray 10.13 D 423-485 None


© NPIDB team 2003 - 2021

text